[KO Validated] Calreticulin Mouse mAb, Unconjugated, Monoclonal

Catalog Number: ABB-A27115
Article Name: [KO Validated] Calreticulin Mouse mAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A27115
Supplier Catalog Number: A27115
Alternative Catalog Number: ABB-A27115-20UL,ABB-A27115-500UL,ABB-A27115-1000UL,ABB-A27115-100UL
Manufacturer: ABclonal
Host: Mouse
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RO, CRT, SSA, cC1qR, HEL-S-99n, Calreticulin
Calreticulin is a highly conserved chaperone protein which resides primarily in the endoplasmic reticulum, and is involved in a variety of cellular processes, among them, cell adhesion. Additionally, it functions in protein folding quality control and calcium homeostasis. Calreticulin is also found in the nucleus, suggesting that it may have a role in transcription regulation. Systemic lupus erythematosus is associated with increased autoantibody titers against calreticulin. Recurrent mutations in calreticulin have been linked to various neoplasms, including the myeloproliferative type.
Clonality: Monoclonal
Molecular Weight: 47kDa
NCBI: 811
UniProt: P27797
Purity: Affinity purification
Sequence: EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFL
Target: CALR
Application Dilute: WB,1:2000 - 1:10000|IHC-P,1:200 - 1:2000|IF/ICC,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag
Western blot analysis of lysates from C6 cells using [KO Validated] Calreticulin Mouse mAb (A27115) at 1:5000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of lysates from wild type (WT) and Calreticulin knockout (KO) HeLa cells using [KO Validated] Calreticulin Mouse mAb (A27115) at 1:5000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of various lysates using [KO Validated] Calreticulin Mouse mAb (A27115) at 1:5000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded Human brain tissue using [KO Validated] Calreticulin Mouse mAb (A27115) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using [KO Validated] Calreticulin Mouse mAb (A27115) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KO Validated] Calreticulin Mouse mAb (A27115) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using [KO Validated] Calreticulin Mouse mAb (A27115) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Confocal imaging of NIH/3T3 cells using [KO Validated] Calreticulin Mouse mAb (A27115, dilution 1:200) followed by a further incubation with Cy3-conjugated Goat Anti-Mouse IgG (H+L) (AS008, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.