IL1beta Rabbit mAb, Unconjugated, Monoclonal

Catalog Number: ABB-A27676
Article Name: IL1beta Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A27676
Supplier Catalog Number: A27676
Alternative Catalog Number: ABB-A27676-100UL,ABB-A27676-500UL,ABB-A27676-1000UL,ABB-A27676-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: Il-1b, IL-1beta, IL1beta
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1. The encoded protein plays a role in thymocyte proliferation and is involved in the inflammatory response.
Clonality: Monoclonal
Molecular Weight: 31kDa
NCBI: 16176
UniProt: P10749
Purity: Affinity purification
Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
Target: Il1b
Application Dilute: WB,1:2000 - 1:4000|IF/ICC,1:100 - 1:200|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Innate Immunity Cytokines InterleukinsMicrobiology Organism Virus RNA Virus ssRNA positive strand virus SARS CoronavirusCardiovascular Atherosclerosis Vascular Inflammation Inflammatory mediatorsMetabolism Types of disease ObesityNeuroscience Processes. Shipping: Ice Bag
Western blot analysis of various lysates using IL1beta Rabbit mAb (A27676) at 1:4000 dilutionincubated at room temperature for 1.5 hours. THP-1 and Raw264.7 cells were treated with LPS (1 µg/mL) at 37°C for 8 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 30 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded SLE Mouse spleen and normal Mouse spleen tissue using IL1beta Rabbit mAb (A27676) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded SLE Mouse spleen tissue using IL1beta Rabbit mAb (A27676) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded SLE Mouse thymus tissue using IL1beta Rabbit mAb (A27676) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Raw264.7 and Raw264.7 treated with LPS using IL1beta Rabbit mAb (A27676) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded THP-1 and THP-1 treated with LPS using IL1beta Rabbit mAb (A27676) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Confocal imaging of RAW 264.7 cells (treated with BFA and LPS) and RAW 264.7 cells (untreated) using IL1beta Rabbit mAb (A27676, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of NR8383 cells (treated with BFA and LPS) and NR8383 cells (untreated) using IL1beta Rabbit mAb (A27676, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of THP-1 cells (treated with LPS) and THP-1 cells (untreated) using IL1beta Rabbit mAb (A27676, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.