Claudin18.2 Rabbit mAb, Unconjugated, Monoclonal

Catalog Number: ABB-A27822
Article Name: Claudin18.2 Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A27822
Supplier Catalog Number: A27822
Alternative Catalog Number: ABB-A27822-100UL,ABB-A27822-1000UL,ABB-A27822-500UL,ABB-A27822-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SFTA5, SFTPJ
This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is upregulated in patients with ulcerative colitis and highly overexpressed in infiltrating ductal adenocarcinomas. PKC/MAPK/AP-1 (protein kinase C/mitogen-activated protein kinase/activator protein-1) dependent pathway regulates the expression of this gene in gastric cells. Alternatively spliced transcript variants encoding different isoforms have been identified.
Clonality: Monoclonal
Molecular Weight: 28kDa
NCBI: 51208
UniProt: P56856
Purity: Affinity purification
Sequence: MVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV
Target: CLDN18
Application Dilute: IF-P,1:200 - 1:800|IHC-P,1:100 - 1:10000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Tight Junctions,Cytoskeleton. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Human stomach(positive sample) and Human colon(negative sample) tissue using Claudin18.2 Rabbit mAb (A27822) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human gastric cancer tissue using Claudin18.2 Rabbit mAb (A27822) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human stomach tissue using Claudin18.2 Rabbit mAb (A27822) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat stomach tissue using Claudin18.2 Rabbit mAb (A27822) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse stomach tissue using Claudin18.2 Rabbit mAb (A27822) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunofluorescence analysis of Rat stomach tissue using Claudin18.2 Rabbit mAb (A27822) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.
Immunofluorescence analysis of Mouse stomach tissue using Claudin18.2 Rabbit mAb (A27822) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.
Immunofluorescence analysis of Human stomach cancer tissue using Claudin18.2 Rabbit mAb (A27822) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.