ALDH3A1 Rabbit mAb, Unconjugated, Monoclonal

Catalog Number: ABB-A27998
Article Name: ALDH3A1 Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A27998
Supplier Catalog Number: A27998
Alternative Catalog Number: ABB-A27998-20UL,ABB-A27998-100UL,ABB-A27998-1000UL,ABB-A27998-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Rat
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AHDC, Aldh, Ahd-c, Aldh3, Aldh3a1
Enables 3-chloroallyl aldehyde dehydrogenase activity. Involved in several processes, including response to cAMP, response to glucocorticoid, and response to hypoxia. Located in cytosol. Human ortholog(s) of this gene implicated in arteriosclerosis. Orthologous to human ALDH3A1 (aldehyde dehydrogenase 3 family member A1).
Clonality: Monoclonal
Molecular Weight: 50kDa
NCBI: 25375
UniProt: P11883
Purity: Affinity purification
Sequence: MSSISDTVKRAREAFNSGKTRSLQFRIQQLEALQRMINENLKSISGALASDLGKNEWTSYYEEVAHVLEELDTTIKELPDWAEDEPVAKTRQTQQDDLYIHSE
Target: Aldh3a1
Application Dilute: WB,1:5000 - 1:20000|IF-P,1:200 - 1:800|IHC-P,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction Metabolism Energy MetabolismNeuroscience Sensory System Visual systemSignal Transduction Metabolism Alcohol metabolismCell Biology Other Antibodies Oxidative StressMetabolism Pathways and Processes Metabolic signaling pathways Alcohol metabolismMetabolism Pathways and Processes Metabolic signaling pathways Energy transfer pathways Energy MetabolismMetabolism Pathways and Processes Redox metabolism Oxidative stress. Shipping: Ice Bag
Western blot analysis of various lysates using ALDH3A1 Rabbit mAb (A27998) at 1:5000 dilutionincubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): U-251 MG
Exposure time: 0.5s.
Western blot analysis of lysates from Rat lung using ALDH3A1 Rabbit mAb (A27998) at 1:5000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using ALDH3A1 Rabbit mAb (A27998) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using ALDH3A1 Rabbit mAb (A27998) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human stomach tissue using ALDH3A1 Rabbit mAb (A27998) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using ALDH3A1 Rabbit mAb (A27998) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human cervix tissue using ALDH3A1 Rabbit mAb (A27998) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using ALDH3A1 Rabbit mAb (A27998) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Confocal imaging of paraffin-embedded Human stomach tissue using ALDH3A1 Rabbit mAb (A27998, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.