SMMHC/MYH11 Rabbit mAb, Unconjugated, Monoclonal

Article Name:	SMMHC/MYH11 Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number:	ABB-A4064
Supplier Catalog Number:	A4064
Alternative Catalog Number:	ABB-A4064-100UL,ABB-A4064-20UL,ABB-A4064-500UL,ABB-A4064-1000UL
Manufacturer:	ABclonal
Host:	Rabbit
Category:	Antikörper
Application:	ELISA, IF, IHC-P, WB
Species Reactivity:	Human
Immunogen:	Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation:	Unconjugated
Alternative Names:	AAT4, FAA4, SMHC, SMMHC, VSCM2, SMMS-1, SMMHC/MYH11

The protein encoded by this gene is a smooth muscle myosin belonging to the myosin heavy chain family. The gene product is a subunit of a hexameric protein that consists of two heavy chain subunits and two pairs of non-identical light chain subunits. It functions as a major contractile protein, converting chemical energy into mechanical energy through the hydrolysis of ATP. A chromosomal rearrangement involving this gene is associated with acute myeloid leukemia of the M4Eo subtype. Mutations in this gene are associated with visceral myopathy, megacystis-microcolon-intestinal hypoperistalsis syndrome 2, and familial thoracic aortic aneurysm 4.

Clonality:	Monoclonal
Clone Designation:	[ARC51911]
Molecular Weight:	227kDa
NCBI:	4629
UniProt:	P35749
Purity:	Affinity purification
Sequence:	DSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASL
Target:	MYH11
Antibody Type:	Primary Antibody

Application Dilute:	WB,1:1000 - 1:5000\|IF-F,1:200 - 1:600\|IF-P,1:400 - 1:1600\|IHC-P,1:500 - 1:5000\|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes:	Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Motor Proteins,Stem Cells,Cardiovascular,Heart,Contractility. Shipping: Ice Bag

	Immunohistochemistry analysis of paraffin-embedded Human lung tissue using SMMHC/MYH11 Rabbit mAb (A4064) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
	Immunohistochemistry analysis of paraffin-embedded Human breast tissue using SMMHC/MYH11 Rabbit mAb (A4064) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
	Western blot analysis of lysates from Rat uterus using SMMHC/MYH11 Rabbit mAb (A4064) at 1:1000 dilution incubated at room temperature for 1.5 hours. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1 s.
	Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using SMMHC/MYH11 Rabbit mAb (A4064) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
	Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using SMMHC/MYH11 Rabbit mAb (A4064) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
	Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using SMMHC/MYH11 Rabbit mAb (A4064) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
	Confocal imaging ofparaffin-embedded Rat small intestine usingSMMHC/MYH11 Rabbit mAb (A4064,dilution 1:800) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.
	Confocal imaging ofparaffin-embedded Human colon usingSMMHC/MYH11 Rabbit mAb (A4064,dilution 1:800) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.
	Confocal imaging ofparaffin-embedded Human colon usingSMMHC/MYH11 Rabbit mAb (A4064,dilution 1:800) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.