HNRNPM Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A6937
- Images (9)
| Article Name: | HNRNPM Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A6937 |
| Supplier Catalog Number: | A6937 |
| Alternative Catalog Number: | ABB-A6937-100UL,ABB-A6937-20UL,ABB-A6937-500UL,ABB-A6937-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, IF, IHC-P, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CEAR, HNRPM, HTGR1, NAGR1, HNRPM4, HNRNPM4, hnRNP M, HNRNPM |
| This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs. This protein also constitutes a monomer of the N-acetylglucosamine-specific receptor which is postulated to trigger selective recycling of immature GlcNAc-bearing thyroglobulin molecules. Alternative splicing results in multiple transcript variants. |
| Clonality: | Polyclonal |
| Molecular Weight: | 78kDa |
| NCBI: | 4670 |
| UniProt: | P52272 |
| Purity: | Affinity purification |
| Sequence: | GFGLERMAAPIDRVGQTIERMGSGVERMGPAIERMGLSMERMVPAGMGAGLERMGPVMDRMATGLERMGANNLERMGLERMGANSLERMGLERMGANSLERMGPAMGPALGAGIERMGLAMGGGGGASFDRAIEMERGNFGGSFAGSFGGAGGHAPGVARKACQIFVRNLPFDFTWKMLKDKFNECGHVLYADIKMENGKSKGCGVVKFESPEVAERACRMMNGMKLSGREIDVRIDRNA |
| Target: | HNRNPM |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse testis using HNRNPM Rabbit pAb (A6937) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human appendix using HNRNPM Rabbit pAb (A6937) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Western blot analysis of various lysates using HNRNPM Rabbit pAb (A6937) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using HNRNPM Rabbit pAb (A6937) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat brain using HNRNPM Rabbit pAb (A6937) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using HNRNPM Rabbit pAb (A6937) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Immunofluorescence analysis of C6 cells using HNRNPM Rabbit pAb (A6937) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of L929 cells using HNRNPM Rabbit pAb (A6937) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of U-2 OS cells using HNRNPM Rabbit pAb (A6937) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
Product Guarantee and Expert Support
