TM9SF1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7461
- Images (1)
| Article Name: | TM9SF1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7461 |
| Supplier Catalog Number: | A7461 |
| Alternative Catalog Number: | ABB-A7461-100UL,ABB-A7461-20UL,ABB-A7461-500UL,ABB-A7461-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | MP70, HMP70, TM9SF1 |
| Predicted to be involved in protein localization to membrane. Predicted to be located in autophagosome membrane, cytoplasmic vesicle, and lysosomal membrane. Predicted to be integral component of membrane. Predicted to be active in membrane. |
| Clonality: | Polyclonal |
| Molecular Weight: | 69kDa |
| NCBI: | 10548 |
| UniProt: | O15321 |
| Purity: | Affinity purification |
| Sequence: | PGVEGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSETSVERRSDRRRGDDGGFFPR |
| Target: | TM9SF1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using TM9SF1 Rabbit pAb (A7461) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 30s. |
Product Guarantee and Expert Support
