POC1A Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7465
- Images (1)
| Article Name: | POC1A Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7465 |
| Supplier Catalog Number: | A7465 |
| Alternative Catalog Number: | ABB-A7465-100UL,ABB-A7465-20UL,ABB-A7465-500UL,ABB-A7465-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | PIX2, SOFT, WDR51A, POC1A |
| POC1 proteins contain an N-terminal WD40 domain and a C-terminal coiled coil domain and are part of centrosomes. They play an important role in basal body and cilia formation. This gene encodes one of the two POC1 proteins found in humans. Mutations in this gene result in short stature, onychodysplasia, facial dysmorphism, and hypotrichosis (SOFT) syndrome. |
| Clonality: | Polyclonal |
| Molecular Weight: | 45kDa |
| NCBI: | 25886 |
| UniProt: | Q8NBT0 |
| Purity: | Affinity purification |
| Sequence: | LFSLSQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKSSRECVHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDVRTHRLLQHYQLHSAAVNGLSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVWKSNFDIVDHGEVTKVPRPPATLASSMGNLPEVDFPVPPGRGRSVESVQSQPQEPVSVPQTLTSTLEHIVGQLDVLTQTVSILEQRLTLTEDKLK |
| Target: | POC1A |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Centrosome. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using POC1A Rabbit pAb (A7465) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
