PCDHA13 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7475
Article Name: PCDHA13 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7475
Supplier Catalog Number: A7475
Alternative Catalog Number: ABB-A7475-20UL,ABB-A7475-100UL,ABB-A7475-500UL,ABB-A7475-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CNR5, CNRN5, CNRS5, CRNR5, PCDH-ALPHA13, PCDHA13
This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.
Clonality: Polyclonal
Molecular Weight: 102kDa
NCBI: 56136
UniProt: Q9Y5I0
Purity: Affinity purification
Sequence: GEIRTKGKLDFEEKKLYEISVEAVDKGNIPMAGHCTLLVEVLDVNDNAPEVTITSLSLPIR
Target: PCDHA13
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Centrosome. Shipping: Ice Bag
Western blot analysis of various lysates using PCDHA13 Rabbit pAb (A7475) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.