ELF2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7487
Article Name: ELF2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7487
Supplier Catalog Number: A7487
Alternative Catalog Number: ABB-A7487-20UL,ABB-A7487-100UL,ABB-A7487-1000UL,ABB-A7487-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: EU32, NERF, NERF-2, NERF-1A, NERF-1B, NERF-1a, b, ELF2
Enables DNA-binding transcription factor activity, RNA polymerase II-specific and sequence-specific double-stranded DNA binding activity. Involved in negative regulation of transcription, DNA-templated, positive regulation of transcription, DNA-templated, and regulation of transcription by RNA polymerase II. Located in cytosol and nuclear body.
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 1998
UniProt: Q15723
Purity: Affinity purification
Sequence: MATSLHEGPTNQLDLLIRAVEASVHSSNAHCTDKTIEAAEALLHMESPTCLRDSRSPVEVFVPPCVSTPEFIHAAMRPDVITETVVEVSTEESEPMDTSPIPTSPDSHEPMKKKKVGRKPKTQQSPISNGSPELGIKKKP
Target: ELF2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of various lysates using ELF2 Rabbit pAb (A7487) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.