DNAJB9 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7494
- Images (1)
| Article Name: | DNAJB9 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7494 |
| Supplier Catalog Number: | A7494 |
| Alternative Catalog Number: | ABB-A7494-100UL,ABB-A7494-20UL,ABB-A7494-1000UL,ABB-A7494-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | MDG1, ERdj4, MDG-1, MST049, MSTP049, DNAJB9 |
| This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. This gene is a member of the type 2 subgroup of DnaJ proteins. The encoded protein is localized to the endoplasmic reticulum. This protein is induced by endoplasmic reticulum stress and plays a role in protecting stressed cells from apoptosis. |
| Clonality: | Polyclonal |
| Molecular Weight: | 26kDa |
| NCBI: | 4189 |
| UniProt: | Q9UBS3 |
| Purity: | Affinity purification |
| Sequence: | SKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ |
| Target: | DNAJB9 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using DNAJB9 Rabbit pAb (A7494) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
