PPP3R2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7495
- Images (1)
| Article Name: | PPP3R2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7495 |
| Supplier Catalog Number: | A7495 |
| Alternative Catalog Number: | ABB-A7495-20UL,ABB-A7495-100UL,ABB-A7495-1000UL,ABB-A7495-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | PPP3RL, PPP3R2 |
| Predicted to enable calcium ion binding activity and calcium-dependent protein serine/threonine phosphatase regulator activity. Predicted to be involved in regulation of catalytic activity. Predicted to act upstream of or within penetration of zona pellucida. Predicted to be located in sperm mitochondrial sheath. Predicted to be part of calcineurin complex. |
| Clonality: | Polyclonal |
| Molecular Weight: | 20kDa |
| NCBI: | 5535 |
| UniProt: | Q96LZ3 |
| Purity: | Affinity purification |
| Sequence: | MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV |
| Target: | PPP3R2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,ErbB-HER Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway,Neuroscience,Calcium Signaling,Neurodegenerative Diseases. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PPP3R2 Rabbit pAb (A7495) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Product Guarantee and Expert Support
