ZNF24 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7500
- Images (1)
| Article Name: | ZNF24 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7500 |
| Supplier Catalog Number: | A7500 |
| Alternative Catalog Number: | ABB-A7500-100UL,ABB-A7500-20UL,ABB-A7500-500UL,ABB-A7500-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | KOX17, RSG-A, ZNF191, ZSCAN3, Zfp191, ZNF24 |
| Enables DNA-binding transcription activator activity, RNA polymerase II-specific, identical protein binding activity, and sequence-specific DNA binding activity. Involved in negative regulation of transcription, DNA-templated and positive regulation of transcription by RNA polymerase II. Located in nucleoplasm. |
| Clonality: | Polyclonal |
| Molecular Weight: | 42kDa |
| NCBI: | 7572 |
| UniProt: | P17028 |
| Purity: | Affinity purification |
| Sequence: | LDAVENQLKWASWELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTLNMGVPQIFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQCGKSYSQSSNLFRHQRRHNAEKLLNVVKV |
| Target: | ZNF24 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using ZNF24 Rabbit pAb (A7500) at 1:900 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
