RAB31 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7506
Article Name: RAB31 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7506
Supplier Catalog Number: A7506
Alternative Catalog Number: ABB-A7506-100UL,ABB-A7506-20UL,ABB-A7506-1000UL,ABB-A7506-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: Rab22B, RAB31
Enables GDP binding activity and GTP binding activity. Involved in several processes, including Golgi to plasma membrane protein transport, cellular response to insulin stimulus, and receptor internalization. Located in early endosome, phagocytic vesicle, and trans-Golgi network membrane. Biomarker of severe acute respiratory syndrome.
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 11031
UniProt: Q13636
Purity: Affinity purification
Sequence: MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC
Target: RAB31
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag
Western blot analysis of various lysates using RAB31 Rabbit pAb (A7506) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.