[KO Validated] RAB1B Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7514
- Images (1)
| Article Name: | [KO Validated] RAB1B Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7514 |
| Supplier Catalog Number: | A7514 |
| Alternative Catalog Number: | ABB-A7514-100UL,ABB-A7514-20UL,ABB-A7514-1000UL,ABB-A7514-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | RAB1B |
| Members of the RAB protein family, such as RAB1B, are low molecular mass monomeric GTPases localized on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB1B functions in the early secretory pathway and is essential for vesicle transport between the endoplasmic reticulum (ER) and Golgi (Chen et al., 1997 [PubMed 9030196], Alvarez et al., 2003 [PubMed 12802079]). |
| Clonality: | Polyclonal |
| Molecular Weight: | 22kDa |
| NCBI: | 81876 |
| UniProt: | Q9H0U4 |
| Purity: | Affinity purification |
| Sequence: | YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC |
| Target: | RAB1B |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from wild type (WT) and RAB1B knockout (KO)HeLa cellsusing[KO Validated] RAB1B Rabbit pAb RAB1B Rabbit pAb (A7514) at1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time:1s. |
Product Guarantee and Expert Support
