ELMOD3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7532
Article Name: ELMOD3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7532
Supplier Catalog Number: A7532
Alternative Catalog Number: ABB-A7532-20UL,ABB-A7532-100UL,ABB-A7532-500UL,ABB-A7532-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LST3, RBED1, RBM29, DFNA81, DFNB88, ELMOD3
This gene encodes a member of the engulfment and cell motility family of GTPase-activating proteins that regulate Arf GTPase proteins. Members of this family are defined by a conserved engulfment and cell motility domain. In rat cochlea, the encoded protein is found in stereocilia, kinocilia and cuticular plate of developing hair cells suggesting a function for this protein in cochlear sensory cells. An allelic variant of this family has been associated with autosomal recessive nonsyndromic deafness-88 in humans. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 84173
UniProt: Q96FG2
Purity: Affinity purification
Sequence: ATFLHLAHVWRTQRKTISDSGFVLKELEVLAKKSPRRLLKTLELYLARVSKGQASLLGAQKCYGPEAPPFKDLTFTGESDLQSHSSEGVWLI
Target: ELMOD3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using ELMOD3 Rabbit pAb (A7532) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.