HLA-G Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7557
- Images (1)
| Article Name: | HLA-G Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7557 |
| Supplier Catalog Number: | A7557 |
| Alternative Catalog Number: | ABB-A7557-20UL,ABB-A7557-100UL,ABB-A7557-1000UL,ABB-A7557-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | MHC-G, HLA-G |
| HLA-G belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-G is expressed on fetal derived placental cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exon 6 encodes the cytoplasmic tail. |
| Clonality: | Polyclonal |
| Molecular Weight: | 38kDa |
| NCBI: | 3135 |
| UniProt: | P17693 |
| Purity: | Affinity purification |
| Sequence: | TETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWAL |
| Target: | HLA-G |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from JEG-3 cells, using HLA-G Rabbit pAb (A7557) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
