Cytokeratin 6 (KRT6) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7560
Article Name: Cytokeratin 6 (KRT6) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7560
Supplier Catalog Number: A7560
Alternative Catalog Number: ABB-A7560-20UL,ABB-A7560-100UL,ABB-A7560-1000UL,ABB-A7560-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: K6A, K6C, K6D, PC3, CK6A, CK6C, CK6D, CK-6C, CK-6E, KRT6C, KRT6D, Cytokeratin 6 (KRT6)
The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. As many as six of this type II cytokeratin (KRT6) have been identified, the multiplicity of the genes is attributed to successive gene duplication events. The genes are expressed with family members KRT16 and/or KRT17 in the filiform papillae of the tongue, the stratified epithelial lining of oral mucosa and esophagus, the outer root sheath of hair follicles, and the glandular epithelia. This KRT6 gene in particular encodes the most abundant isoform. Mutations in these genes have been associated with pachyonychia congenita. In addition, peptides from the C-terminal region of the protein have antimicrobial activity against bacterial pathogens. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 3853
UniProt: P02538
Purity: Affinity purification
Sequence: MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSVSVSRSRGSGGLGGACGGAGFGSRSLYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGF
Target: KRT6A
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Extracellular Matrix,Keratin. Shipping: Ice Bag
Western blot analysis of various lysates using Cytokeratin 6 (KRT6) Rabbit pAb (A7560) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.