CCL3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7568
Article Name: CCL3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7568
Supplier Catalog Number: A7568
Alternative Catalog Number: ABB-A7568-100UL,ABB-A7568-20UL,ABB-A7568-1000UL,ABB-A7568-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MIP1A, SCYA3, G0S19-1, LD78ALPHA, MIP-1-alpha, CCL3
This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.
Clonality: Polyclonal
Molecular Weight: 10kDa
NCBI: 6348
UniProt: P10147
Purity: Affinity purification
Sequence: SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Target: CCL3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag
Western blot analysis of lysates from THP-1 cells, using CCL3 Rabbit pAb (A7568) at 1:1000 dilution. THP-1 cells were treated with LPS for 6 hours and Brefeldin A for 3 hours of stimulation.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.