DIMT1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7589
Article Name: DIMT1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7589
Supplier Catalog Number: A7589
Alternative Catalog Number: ABB-A7589-20UL,ABB-A7589-100UL,ABB-A7589-1000UL,ABB-A7589-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DIM1, DIMT1L, HUSSY5, HSA9761, DIMT1
The protein encoded by this gene is a methyltransferase that is responsible for dimethylation of adjacent adenosines near the 18S rRNA decoding site. The encoded protein is essential for ribosome biogenesis, although its catalytic activity is not involved in the process. The yeast ortholog of this protein functions in the cytoplasm while this protein functions in the nucleus.
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 27292
UniProt: Q9UNQ2
Purity: Affinity purification
Sequence: MPKVKSGAIGRRRGRQEQRRELKSAGGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCV
Target: DIMT1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag
Western blot analysis of various lysates using DIMT1 Rabbit pAb (A7589) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.