UGT3A2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7611
Article Name: UGT3A2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7611
Supplier Catalog Number: A7611
Alternative Catalog Number: ABB-A7611-20UL,ABB-A7611-100UL,ABB-A7611-1000UL,ABB-A7611-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: UGT3A2
Enables UDP-glycosyltransferase activity. Acts upstream of or within cellular response to genistein. Predicted to be integral component of membrane. Predicted to be active in intracellular membrane-bounded organelle.
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 167127
UniProt: Q3SY77
Purity: Affinity purification
Sequence: AKILTISTVGGSHYLLMDRVSQILQDHGHNVTMLNHKRGPFMPDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEETLGGRGKFENLLNVLEYLALQCSHFLNRKDIMDSLKNENFDMVIVETFDYCPFLIAEKLGKPFVAILSTSFGSLEFGLPIPLSYVPVFRSLLTDHMDFWGRVKNFLMFFSFCRRQQHMQSTFDNTIKEHFTEGSRPVLSHLLLKAELWFINSDFAFDFARPLLPNTVYVGGLMEKPIK
Target: UGT3A2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Endocrine Metabolism,Drug metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using UGT3A2 Rabbit pAb (A7611) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.