CSF3R Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7661
Article Name: CSF3R Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7661
Supplier Catalog Number: A7661
Alternative Catalog Number: ABB-A7661-20UL,ABB-A7661-100UL,ABB-A7661-500UL,ABB-A7661-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SCN7, CD114, GCSFR, CSF3R
The protein encoded by this gene is the receptor for colony stimulating factor 3, a cytokine that controls the production, differentiation, and function of granulocytes. The encoded protein, which is a member of the family of cytokine receptors, may also function in some cell surface adhesion or recognition processes. Alternatively spliced transcript variants have been described. Mutations in this gene are a cause of Kostmann syndrome, also known as severe congenital neutropenia.
Clonality: Polyclonal
Molecular Weight: 92kDa
NCBI: 1441
UniProt: Q99062
Purity: Affinity purification
Sequence: CSPNRKNPLWPSVPDPAHSSLGSWVPTIMEEDAFQLPGLGTPPITKLTVLEEDEKKPVPWESHNSSETCGLPTLVQTYVLQGDPRAVSTQPQSQSGTSDQV
Target: CSF3R
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Immunology Inflammation,CDs. Shipping: Ice Bag
Western blot analysis of various lysates using CSF3R Rabbit pAb (A7661) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.