DLX6 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7667
- Images (1)
| Article Name: | DLX6 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7667 |
| Supplier Catalog Number: | A7667 |
| Alternative Catalog Number: | ABB-A7667-100UL,ABB-A7667-20UL,ABB-A7667-500UL,ABB-A7667-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | DLX6 |
| This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This gene is in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7. |
| Clonality: | Polyclonal |
| Molecular Weight: | 20kDa |
| NCBI: | 1750 |
| UniProt: | P56179 |
| Purity: | Affinity purification |
| Sequence: | MSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM |
| Target: | DLX6 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using DLX6 Rabbit pAb (A7667) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 60s. |
Product Guarantee and Expert Support
