GYPB Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7682
Article Name: GYPB Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7682
Supplier Catalog Number: A7682
Alternative Catalog Number: ABB-A7682-100UL,ABB-A7682-20UL,ABB-A7682-500UL,ABB-A7682-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SS, GPB, GYP, MNS, GYPA, PAS-3, CD235b, GYPB
Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. GYPB gene consists of 5 exons and has 97% sequence homology with GYPA from the 5 UTR to the coding sequence encoding the first 45 amino acids. In addition to the M or N and S or s antigens, that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta, also, Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB. Alternate splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 10kDa
NCBI: 2994
UniProt: P06028
Purity: Affinity purification
Sequence: MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYTIRRLIKA
Target: GYPB
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Immunology Inflammation,CDs,Cardiovascular,Blood. Shipping: Ice Bag
Western blot analysis of lysates from Human serum, using GYPB Rabbit pAb (A7682) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.