ITGA9 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7693
- Images (1)
| Article Name: | ITGA9 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7693 |
| Supplier Catalog Number: | A7693 |
| Alternative Catalog Number: | ABB-A7693-100UL,ABB-A7693-20UL,ABB-A7693-500UL,ABB-A7693-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | RLC, ITGA4L, ALPHA-RLC, ITGA9 |
| This gene encodes an alpha integrin. Integrins are heterodimeric integral membrane glycoproteins composed of an alpha chain and a beta chain that mediate cell-cell and cell-matrix adhesion. The protein encoded by this gene, when bound to the beta 1 chain, forms an integrin that is a receptor for VCAM1, cytotactin and osteopontin. Expression of this gene has been found to be upregulated in small cell lung cancers. |
| Clonality: | Polyclonal |
| Molecular Weight: | 114kDa |
| NCBI: | 3680 |
| UniProt: | Q13797 |
| Purity: | Affinity purification |
| Sequence: | YNLDPQRPVHFQGPADSFFGYAVLEHFHDNTRWVLVGAPKADSKYSPSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGTSCGKTCREDRDDEWMGVSLARQPKADGRVLACAHRWKNIYYEADHILPHGFCYIIPSNLQAKGRTLIPCYEEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTIKVLNLTDNTYLKLNDEVIMNRRYTYLGYA |
| Target: | ITGA9 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,PI3K-Akt Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ITGA9 Rabbit pAb (A7693) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 90s. |
Product Guarantee and Expert Support
