Cytokeratin 13 (KRT13) Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7697
- Images (1)
| Article Name: | Cytokeratin 13 (KRT13) Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7697 |
| Supplier Catalog Number: | A7697 |
| Alternative Catalog Number: | ABB-A7697-20UL,ABB-A7697-100UL,ABB-A7697-500UL,ABB-A7697-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | K13, CK13, WSN2, Cytokeratin 13 (KRT13) |
| The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. Mutations in this gene and keratin 4 have been associated with the autosomal dominant disorder White Sponge Nevus. The type I cytokeratins are clustered in a region of chromosome 17q21.2. Alternative splicing of this gene results in multiple transcript variants, however, not all variants have been described. |
| Clonality: | Polyclonal |
| Molecular Weight: | 50kDa |
| NCBI: | 3860 |
| UniProt: | P13646 |
| Purity: | Affinity purification |
| Sequence: | DLTRVLAEMREQYEAMAERNRRDAEEWFHAKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP |
| Target: | KRT13 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Extracellular Matrix,Keratin. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using Cytokeratin 13 (KRT13) Rabbit pAb (A7697) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
