STXBP2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7735
- Images (1)
| Article Name: | STXBP2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7735 |
| Supplier Catalog Number: | A7735 |
| Alternative Catalog Number: | ABB-A7735-100UL,ABB-A7735-20UL,ABB-A7735-500UL,ABB-A7735-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | FHL5, UNC18B, Hunc18b, UNC18-2, pp10122, unc-18B, MUNC18-2, STXBP2 |
| This gene encodes a member of the STXBP/unc-18/SEC1 family. The encoded protein is involved in intracellular trafficking, control of SNARE (soluble NSF attachment protein receptor) complex assembly, and the release of cytotoxic granules by natural killer cells. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 66kDa |
| NCBI: | 6813 |
| UniProt: | Q15833 |
| Purity: | Affinity purification |
| Sequence: | MAPSGLKAVVGEKILSGVIRSVKKDGEWKVLIMDHPSMRILSSCCKMSDILAEGITIVEDINKRREPIPSLEAIYLLSPTEKALIKDFQGTPTFTYKAAHIFFTDTCPEPLFSELGRSRLAKVVKTLKEIHLAFLPYEAQVFSLDAPHSTYNLYCPFRAEERTRQLEVLAQQIATLCATLQEYPAIRYRKGPEDTAQLAHAVLAKLNAFKADTPSLGEGPEKTRSQLLIMDRAADPVSPLLHELTFQAMAYDLLD |
| Target: | STXBP2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using STXBP2 Rabbit pAb (A7735) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
