Contactin 2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7738
- Images (1)
| Article Name: | Contactin 2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7738 |
| Supplier Catalog Number: | A7738 |
| Alternative Catalog Number: | ABB-A7738-100UL,ABB-A7738-20UL,ABB-A7738-1000UL,ABB-A7738-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | AXT, TAX, TAX1, FAME5, TAG-1, Contactin 2 |
| This gene encodes a member of the contactin family of proteins, part of the immunoglobulin superfamily of cell adhesion molecules. The encoded glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein plays a role in the proliferation, migration, and axon guidance of neurons of the developing cerebellum. A mutation in this gene may be associated with adult myoclonic epilepsy. |
| Clonality: | Polyclonal |
| Molecular Weight: | 113kDa |
| NCBI: | 6900 |
| UniProt: | Q02246 |
| Purity: | Affinity purification |
| Sequence: | EVKIRSYNRRGDGPESLTALVYSAEEEPRVAPTKVWAKGVSSSEMNVTWEPVQQDMNGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVEN |
| Target: | CNTN2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Cell Biology Developmental Biology,Cell Adhesion,Immunology Inflammation,NF-kB Signaling Pathway,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using Contactin 2 Rabbit pAb (A7738) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
