SCG3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7799
- Images (1)
| Article Name: | SCG3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7799 |
| Supplier Catalog Number: | A7799 |
| Alternative Catalog Number: | ABB-A7799-20UL,ABB-A7799-100UL,ABB-A7799-500UL,ABB-A7799-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | SGIII, SCG3 |
| The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Granins may serve as precursors for biologically active peptides. Some granins have been shown to function as helper proteins in sorting and proteolytic processing of prohormones, however, the function of this protein is unknown. Two transcript variants encoding different isoforms have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 53kDa |
| NCBI: | 29106 |
| UniProt: | Q8WXD2 |
| Purity: | Affinity purification |
| Sequence: | KLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDNISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLKKHDKKGNKEDYDLSKMRDFINKQADAYVEKGIL |
| Target: | SCG3 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cancer,Endocrine Metabolism,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using SCG3 Rabbit pAb (A7799) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. |
Product Guarantee and Expert Support
