SLC22A11 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7816
Article Name: SLC22A11 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7816
Supplier Catalog Number: A7816
Alternative Catalog Number: ABB-A7816-100UL,ABB-A7816-20UL,ABB-A7816-500UL,ABB-A7816-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: OAT4, hOAT4, SLC22A11
The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 55867
UniProt: Q9NSA0
Purity: Affinity purification
Sequence: FSAAIPGHRCWTHMLDNGSAVSTNMTPKALLTISIPPGPNQGPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYDRSVFTSTIVAKWDLVCSSQG
Target: SLC22A11
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using SLC22A11 Rabbit pAb (A7816) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.