PRDM6 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7846
- Images (1)
| Article Name: | PRDM6 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7846 |
| Supplier Catalog Number: | A7846 |
| Alternative Catalog Number: | ABB-A7846-20UL,ABB-A7846-100UL,ABB-A7846-1000UL,ABB-A7846-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | PDA3, KMT8C, PRISM, PRDM6 |
| The protein encoded by this gene is a transcriptional repressor and a member of the PRDM family. Family members contain a PR domain and multiple zinc-finger domains. The encoded protein is involved in regulation of vascular smooth muscle cells (VSMC) contractile proteins. Mutations in this gene result in patent ductus arteriosus 3 (PDA3). |
| Clonality: | Polyclonal |
| Molecular Weight: | 64kDa |
| NCBI: | 93166 |
| UniProt: | Q9NQX0 |
| Purity: | Affinity purification |
| Sequence: | LQCIAQDENLNVPSTVMEAMCRQDALQPFNKSSKLAPTTQQRSVVFPQTPCSRNFSLLDKSGPIESGFNQINVKNQRVLASPTSTSQLHSEFSDWHLWKCGQCFKTFTQRILLQMHVCTQNPDRPYQCGHCSQSFSQPSELRNHVVTHSSDRPFKCGYCGRAFAGATTLNNHIRTHTGEKPFKCERCERSFTQATQLSRHQRMPNECKPITESPESIEVD |
| Target: | PRDM6 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PRDM6 Rabbit pAb (A7846) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
