SPICE1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7855
Article Name: SPICE1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7855
Supplier Catalog Number: A7855
Alternative Catalog Number: ABB-A7855-20UL,ABB-A7855-100UL,ABB-A7855-500UL,ABB-A7855-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SPICE, CCDC52, SPICE1
Involved in metaphase plate congression, mitotic spindle assembly, and regulation of centriole replication. Located in centriole, centrosome, and spindle.
Clonality: Polyclonal
Molecular Weight: 96kDa
NCBI: 152185
UniProt: Q8N0Z3
Purity: Affinity purification
Sequence: MSFVRVNRCGPRVGVRKTPKVKKKKTSVKQEWDNTVTDLTVHRATPEDLVRRHEIHKSKNRALVHWELQEKALKRKWRKQKPETLNLEKRRLSIMKEILSDQYQMQDVLEKSDHLIAAAKELFPRRRTGFPNVTVAPDSSQGPIVVNQDPITQSIFNESVIEPQALNDVDGEEEGTVNSQSGESENENELDNSLNSQSNTNTDRFLQQLTEENFELISKL
Target: SPICE1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Cycle,Centrosome. Shipping: Ice Bag
Western blot analysis of various lysates using SPICE1 Rabbit pAb (A7855) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.