ING1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7904
- Images (1)
| Article Name: | ING1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7904 |
| Supplier Catalog Number: | A7904 |
| Alternative Catalog Number: | ABB-A7904-100UL,ABB-A7904-20UL,ABB-A7904-500UL,ABB-A7904-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | p33, p47, p33ING1, p24ING1c, p33ING1b, p47ING1a, ING1 |
| This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. |
| Clonality: | Polyclonal |
| Molecular Weight: | 47kDa |
| NCBI: | 3621 |
| UniProt: | Q9UK53 |
| Purity: | Affinity purification |
| Sequence: | LRCGWFSSWPPPSKSAIPIGGGSRGAGRVSRWPPPHWLEAWRVSPLPLSPLSPATFGRGFIAVAVIPGLWARGRGCSSDRLPRPAGPARRQFQAASLLTRGWGRAWPWKQILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQ |
| Target: | ING1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor suppressors,p53 pathway,Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from HT-29 cells usingING1 Rabbit pAb (A7904) at1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
