TFAP2B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7935
Article Name: TFAP2B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7935
Supplier Catalog Number: A7935
Alternative Catalog Number: ABB-A7935-20UL,ABB-A7935-100UL,ABB-A7935-1000UL,ABB-A7935-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PDA2, AP-2B, AP2-B, AP-2beta, TFAP2B
This gene encodes a member of the AP-2 family of transcription factors. AP-2 proteins form homo- or hetero-dimers with other AP-2 family members and bind specific DNA sequences. They are thought to stimulate cell proliferation and suppress terminal differentiation of specific cell types during embryonic development. Specific AP-2 family members differ in their expression patterns and binding affinity for different promoters. This protein functions as both a transcriptional activator and repressor. Mutations in this gene result in autosomal dominant Char syndrome, suggesting that this gene functions in the differentiation of neural crest cell derivatives.
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 7021
UniProt: Q92481
Purity: Affinity purification
Sequence: MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSSAPPLSHTPSSDFQPPYFPPPYQPLPYHQSQDPYSHVNDPYSLNPLHQ
Target: TFAP2B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation. Shipping: Ice Bag
Western blot analysis of various lysates, using TFAP2B Rabbit pAb (A7935) at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.