TFE3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A7936
- Images (1)
| Article Name: | TFE3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A7936 |
| Supplier Catalog Number: | A7936 |
| Alternative Catalog Number: | ABB-A7936-100UL,ABB-A7936-20UL,ABB-A7936-500UL,ABB-A7936-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | TFEA, RCCP2, RCCX1, MRXSPF, bHLHe33, TFE3 |
| This gene encodes a basic helix-loop-helix domain-containing transcription factor that binds MUE3-type E-box sequences in the promoter of genes. The encoded protein promotes the expression of genes downstream of transforming growth factor beta (TGF-beta) signaling. This gene may be involved in chromosomal translocations in renal cell carcinomas and other cancers, resulting in the production of fusion proteins. Translocation partners include PRCC (papillary renal cell carcinoma), NONO (non-POU domain containing, octamer-binding), and ASPSCR1 (alveolar soft part sarcoma chromosome region, candidate 1), among other genes. Alternative splicing results in multiple transcript variants. |
| Clonality: | Polyclonal |
| Molecular Weight: | 62kDa |
| NCBI: | 7030 |
| UniProt: | P19532 |
| Purity: | Affinity purification |
| Sequence: | MSHAAEPARDGVEASAEGPRAVFVLLEERRPADSAQLLSLNSLLPESGIVADIELENVLDPDSFYELKSQPLPLRSSLPISLQATPATPATLSASSSAGGSRTPAMSSSSSSRVLLRQQLMRAQAQEQERRERREQAAAAPFPSPAPASPAISVVGVSAG |
| Target: | TFE3 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Immunology Inflammation. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using TFE3 Rabbit pAb (A7936) at 1:400 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 30s. |
Product Guarantee and Expert Support
