ST3GAL5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7947
Article Name: ST3GAL5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7947
Supplier Catalog Number: A7947
Alternative Catalog Number: ABB-A7947-100UL,ABB-A7947-20UL,ABB-A7947-1000UL,ABB-A7947-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SATI, SIAT9, SPDRS, ST3GalV, SIATGM3S, ST3Gal V, ST3GAL5
Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. The protein encoded by this gene is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. The encoded protein is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in this gene has been associated with Amish infantile epilepsy syndrome. Transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 8869
UniProt: Q9UNP4
Purity: Affinity purification
Sequence: LYILKLNYTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKECRPKFAKTSMALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS
Target: ST3GAL5
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates using ST3GAL5 Rabbit pAb (A7947) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.