ARTN Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A7949
Article Name: ARTN Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A7949
Supplier Catalog Number: A7949
Alternative Catalog Number: ABB-A7949-20UL,ABB-A7949-100UL,ABB-A7949-500UL,ABB-A7949-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ART, EVN, NBN, ENOVIN, ARTN
This gene encodes a secreted ligand of the glial cell line-derived neurotrophic factor (GDNF) subfamily and TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein signals through the RET receptor and GFR alpha 3 coreceptor, and supports the survival of a number of peripheral neuron populations and at least one population of dopaminergic CNS neurons. This protein has also been shown to promote tumor growth, metastasis, and drug resistance in mammary carcinoma.
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 9048
UniProt: Q5T4W7
Purity: Affinity purification
Sequence: GCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG
Target: ARTN
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Growth factors,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from 22Rv1 cells, using ARTN Rabbit pAb (A7949) at 1:500 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 30s.