CEACAM7 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A8112
- Images (1)
| Article Name: | CEACAM7 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A8112 |
| Supplier Catalog Number: | A8112 |
| Alternative Catalog Number: | ABB-A8112-100UL,ABB-A8112-20UL,ABB-A8112-500UL,ABB-A8112-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CGM2, CEACAM7 |
| This gene encodes a cell surface glycoprotein and member of the carcinoembryonic antigen (CEA) family of proteins. Expression of this gene may be downregulated in colon and rectal cancer. Additionally, lower expression levels of this gene may be predictive of rectal cancer recurrence. This gene is present in a CEA family gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants. |
| Clonality: | Polyclonal |
| Molecular Weight: | 29kDa |
| NCBI: | 1087 |
| UniProt: | Q14002 |
| Purity: | Affinity purification |
| Sequence: | TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS |
| Target: | CEACAM7 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CEACAM7 Rabbit pAb (A8112) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
