MGAT3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A8134
- Images (1)
| Article Name: | MGAT3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A8134 |
| Supplier Catalog Number: | A8134 |
| Alternative Catalog Number: | ABB-A8134-100UL,ABB-A8134-20UL,ABB-A8134-1000UL,ABB-A8134-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | GNT3, GNT-III, MGAT3 |
| There are believed to be over 100 different glycosyltransferases involved in the synthesis of protein-bound and lipid-bound oligosaccharides. The enzyme encoded by this gene transfers a GlcNAc residue to the beta-linked mannose of the trimannosyl core of N-linked oligosaccharides and produces a bisecting GlcNAc. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
| Clonality: | Polyclonal |
| Molecular Weight: | 61kDa |
| NCBI: | 4248 |
| UniProt: | Q09327 |
| Purity: | Affinity purification |
| Sequence: | GCTVDMLQAVYGLDGIRLRRRQYYTMPNFRQYENRTGHILVQWSLGSPLHFAGWHCSWCFTPEGIYFKLVSAQNGDFPRWGDYEDKRDLNYIRGLIRTGGWFDGTQQEYPPADPSEHMYAPKYLLKNYDRFHYLLDNPYQEPRSTAAGGWRHRGPEGRPPARGKLDEAEV |
| Target: | MGAT3 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse kidney, using MGAT3 Rabbit pAb (A8134) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Product Guarantee and Expert Support
