SGSH Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A8148
- Images (1)
| Article Name: | SGSH Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A8148 |
| Supplier Catalog Number: | A8148 |
| Alternative Catalog Number: | ABB-A8148-100UL,ABB-A8148-20UL,ABB-A8148-1000UL,ABB-A8148-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | HSS, SFMD, MPS3A, SGSH |
| This gene encodes the enzyme sulfamidase, one of several enzymes involved in the lysosomal degradation of heparan sulfate. Mutations in this gene are associated with the lysosomal storage disease mucopolysaccaridosis IIIA, also known as Sanfilippo syndrome A, which results from impaired degradation of heparan sulfate. Transcripts of varying sizes have been reported but their biological validity has not been determined. |
| Clonality: | Polyclonal |
| Molecular Weight: | 57kDa |
| NCBI: | 6448 |
| UniProt: | P51688 |
| Purity: | Affinity purification |
| Sequence: | DNGIPFPSGRTNLYWPGTAEPLLVSSPEHPKRWGQVSEAYVSLLDLTPTILDWFSIPYPSYAIFGSKTIHLTGRSLLPALEAEPLWATVFGSQSHHEVTMSYPMRSVQHRHFRLVHNLNFKMPFPIDQDFYVSPTFQDLLNRTTAGQPTGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAPDGVLEEKLSPQCQPLHNEL |
| Target: | SGSH |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse lung, using SGSH Rabbit pAb (A8148) at 1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
