USF2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8158
Article Name: USF2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8158
Supplier Catalog Number: A8158
Alternative Catalog Number: ABB-A8158-20UL,ABB-A8158-100UL,ABB-A8158-500UL,ABB-A8158-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: FIP, bHLHb12, USF2
This gene encodes a member of the basic helix-loop-helix leucine zipper family of transcription factors. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs and is involved in regulating multiple cellular processes.
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 7392
UniProt: Q15853
Purity: Affinity purification
Sequence: VVSTAAFAGGQQAVTQVGVDGAAQRPGPAAASVPPGPAAPFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTDQSLQAGGQFYVMM
Target: USF2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of lysates from Rat liver, using USF2 Rabbit pAb (A8158) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.