POP7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8183
Article Name: POP7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8183
Supplier Catalog Number: A8183
Alternative Catalog Number: ABB-A8183-100UL,ABB-A8183-20UL,ABB-A8183-500UL,ABB-A8183-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RPP2, RPP20, 0610037N12Rik, POP7
Enables ribonuclease P RNA binding activity. Contributes to ribonuclease P activity. Involved in tRNA 5-leader removal. Located in nucleolus. Part of multimeric ribonuclease P complex and ribonuclease MRP complex.
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 10248
UniProt: O75817
Purity: Affinity purification
Sequence: MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
Target: POP7
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using POP7 Rabbit pAb (A8183) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.