AKR7A3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8194
Article Name: AKR7A3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8194
Supplier Catalog Number: A8194
Alternative Catalog Number: ABB-A8194-20UL,ABB-A8194-100UL,ABB-A8194-500UL,ABB-A8194-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AFAR2, AKR7A3
Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 22977
UniProt: O95154
Purity: Affinity purification
Sequence: MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGGLGLRLGGSDCRVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVEETLRACHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTWAEMYRNRYWKEHHFEGIALVEKALQAA
Target: AKR7A3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using AKR7A3 Rabbit pAb (A8194) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.