Septin 6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8196
Article Name: Septin 6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8196
Supplier Catalog Number: A8196
Alternative Catalog Number: ABB-A8196-20UL,ABB-A8196-100UL,ABB-A8196-1000UL,ABB-A8196-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SEP2, SEPT2, SEPT6, Septin 6
This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis. One version of pediatric acute myeloid leukemia is the result of a reciprocal translocation between chromosomes 11 and X, with the breakpoint associated with the genes encoding the mixed-lineage leukemia and septin 2 proteins. This gene encodes four transcript variants encoding three distinct isoforms. An additional transcript variant has been identified, but its biological validity has not been determined.
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 23157
UniProt: Q14141
Purity: Affinity purification
Sequence: VKEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRKTAAELLQSQGSQAGGSQTLKRDKEKKNNPWLCTE
Target: SEPTIN6
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Immunology Inflammation,Cytokines. Shipping: Ice Bag
Western blot analysis of lysates from Rat lung, using Septin 6 Rabbit pAb (A8196) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.