PARL Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A8232
- Images (1)
| Article Name: | PARL Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A8232 |
| Supplier Catalog Number: | A8232 |
| Alternative Catalog Number: | ABB-A8232-20UL,ABB-A8232-100UL,ABB-A8232-500UL,ABB-A8232-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, IF, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | PSARL, PSARL1, RHBDS1, PRO2207, PSENIP2, PARL |
| This gene encodes a member of the rhomboid family of intramembrane serine proteases that is localized to the inner mitochondrial membrane. The encoded protein regulates mitochondrial remodeling and apoptosis through regulated substrate proteolysis. Proteolytic processing of the encoded protein results in the release of a small peptide, P-beta, which may transit to the nucleus. Mutations in this gene may be associated with Parkinsons disease. |
| Clonality: | Polyclonal |
| Molecular Weight: | 42kDa |
| NCBI: | 55486 |
| UniProt: | Q9H300 |
| Purity: | Affinity purification |
| Sequence: | MAWRGWAQRGWGCGQAWGASVGGRSCEELTAVLTPPQLLGRRFNFFIQQKCGFRKAPRKVEPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQRTVT |
| Target: | PARL |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Ubiquitin,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PARL Rabbit pAb (A8232) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
