DACT3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A8280
- Images (1)
| Article Name: | DACT3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A8280 |
| Supplier Catalog Number: | A8280 |
| Alternative Catalog Number: | ABB-A8280-100UL,ABB-A8280-20UL,ABB-A8280-500UL,ABB-A8280-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | RRR1, DAPPER3, DACT3 |
| Predicted to enable delta-catenin binding activity, protein kinase A binding activity, and protein kinase C binding activity. Involved in negative regulation of canonical Wnt signaling pathway and negative regulation of cell growth. Predicted to be active in cytoplasm. |
| Clonality: | Polyclonal |
| Molecular Weight: | 65kDa |
| NCBI: | 147906 |
| UniProt: | Q96B18 |
| Purity: | Affinity purification |
| Sequence: | MIRAFSFPVSPERGRLRGWLEGSLAGLCELHWLRERQEYRVQQALRLAQPGMGGAEAEDEEDADEDEDAAAARRAAAALEEQLEALPGLVWDLGQQLGDLSLESGGLEQESGRSSGFYEDPSSTGGPDSPPSTFCGDSGFSGSSSYGRLGPSEPRGIYAS |
| Target: | DACT3 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Neuroscience,Stem Cells. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using DACT3 Rabbit pAb (A8280) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
