FZD9 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8311
Article Name: FZD9 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8311
Supplier Catalog Number: A8311
Alternative Catalog Number: ABB-A8311-20UL,ABB-A8311-100UL,ABB-A8311-1000UL,ABB-A8311-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: FZD3, CD349, FZD9
Members of the frizzled gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD9 gene is located within the Williams syndrome common deletion region of chromosome 7, and heterozygous deletion of the FZD9 gene may contribute to the Williams syndrome phenotype. FZD9 is expressed predominantly in brain, testis, eye, skeletal muscle, and kidney.
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 8326
UniProt: O00144
Purity: Affinity purification
Sequence: ERLNMDFWRLRATEQPCAAAAGPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCYRKIAAGRARAKACRAPGSYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL
Target: FZD9
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,mTOR Signaling Pathway,Cell Biology Developmental Biology,Wnt -Catenin Signaling Pathway,ESC Pluripotency and Differentiation,Immunology Inflammation,CDs,Neuroscience,Stem Cells,Neural Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using FZD9 Rabbit pAb (A8311) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.