CEP44 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8317
Article Name: CEP44 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8317
Supplier Catalog Number: A8317
Alternative Catalog Number: ABB-A8317-100UL,ABB-A8317-20UL,ABB-A8317-1000UL,ABB-A8317-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PS1TP3, KIAA1712, CEP44
Enables microtubule binding activity. Involved in centriole replication and centriole-centriole cohesion. Located in centriole, centrosome, and spindle pole.
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 80817
UniProt: Q9C0F1
Purity: Affinity purification
Sequence: MATGDLKRSLRNLEQVLRLLNYPEEVDCVGLIKGDPAASLPIISYSFTSYSPYVTELIMESNVELIAKNDLRFIDAVYKLLRDQFNYKPILTKKQFIQCGFAEWKIQIVCDILNCVMKKHKELSSLQKIPSQQRKKISSGKSEPPLGNEKISAEAVGVDISGRFMTSGKKKAVVIRHLYNEDNVDISEDTLSPITDVNEAVDVSDLNATEIKMPEVKVPEIKAEQQDVNVNPEITALQTMLAECQENLKKLTSIE
Target: CEP44
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Centrosome. Shipping: Ice Bag
Western blot analysis of various lysates using CEP44 Rabbit pAb (A8317) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.