MEIS2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8437
Article Name: MEIS2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8437
Supplier Catalog Number: A8437
Alternative Catalog Number: ABB-A8437-100UL,ABB-A8437-20UL,ABB-A8437-500UL,ABB-A8437-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MRG1, CPCMR, HsT18361, MEIS2
This gene encodes a homeobox protein belonging to the TALE (three amino acid loop extension) family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene.
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 4212
UniProt: O14770
Purity: Affinity purification
Sequence: AYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMSMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ
Target: MEIS2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using MEIS2 Rabbit pAb (A8437) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.