Endomucin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A8494
Article Name: Endomucin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A8494
Supplier Catalog Number: A8494
Alternative Catalog Number: ABB-A8494-100UL,ABB-A8494-20UL,ABB-A8494-500UL,ABB-A8494-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: EMCN2, MUC14, Endomucin
EMCN is a mucin-like sialoglycoprotein that interferes with the assembly of focal adhesion complexes and inhibits interaction between cells and the extracellular matrix (Kinoshita et al., 2001 [PubMed 11418125]).
Clonality: Polyclonal
Molecular Weight: 27kDa
NCBI: 51705
UniProt: Q9ULC0
Purity: Affinity purification
Sequence: NSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTT
Target: EMCN
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Cardiovascular,Angiogenesis. Shipping: Ice Bag
Western blot analysis of various lysates using Endomucin Rabbit pAb (A8494) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.